SMC1 Antibody (1B9) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
SMC1L1 (NP_006297, 366 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM |
| Specificity |
SMC1L1 - SMC1 structural maintenance of chromosomes 1-like 1 (yeast) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SMC1A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SMC1 Antibody (1B9) - Azide and BSA Free
Background
Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Publications for SMC1 Antibody (H00008243-M01) (0)
There are no publications for SMC1 Antibody (H00008243-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMC1 Antibody (H00008243-M01) (0)
There are no reviews for SMC1 Antibody (H00008243-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SMC1 Antibody (H00008243-M01). (Showing 1 - 2 of 2 FAQ).
-
I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?
- My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.
-
My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.
- We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.
Secondary Antibodies
| |
Isotype Controls
|
Additional SMC1 Products
Research Areas for SMC1 Antibody (H00008243-M01)
Find related products by research area.
|
Blogs on SMC1