SMARCD3 Antibody

Western Blot: SMARCD3 Antibody [NBP2-39013] - Analysis in human cell lines HEK293 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SMARCD3 Antibody [NBP2-39013] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Immunohistochemistry: SMARCD3 Antibody [NBP2-39013] - Staining of human heart muscle shows strong nuclear positivity in myocytes.

Product Discontinued

SMARCD3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMARCD3 Antibody

• 60 kDa BRG-1/Brm-associated factor subunit C
• 60kDa BRG-1/Brm associated factor subunit c
• BAF60Cchromatin remodeling complex BAF60C subunit
• BRG1-associated factor 60C
• CRACD3
• mammalian chromatin remodeling complex BRG1-associated factor 60C
• MGC111010
• Rsc6p
• subfamily d, member 3
• SWI/SNF complex 60 kDa subunit C
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3
• Swp73-like protein

Background

SMARCD3 is encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCD3
• Uniprot:
  • Q6STE5(Human)