Recombinant Human SMARCD2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMARCD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 398-474 of Human SMARCD2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL

Protein/Peptide Type
Partial Recombinant Protein
Gene
SMARCD2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMARCD2 Protein

  • 60 kDa BRG-1/Brm-associated factor subunit B
  • BAF60B
  • BRG1-associated factor 60B
  • chromatin remodeling complex BAF60B subunit
  • CRACD2
  • mammalian chromatin remodeling complex BRG1-associated factor 60B
  • PRO2451
  • Rsc6p
  • SWI/SNF complex 60 kDa subunit B
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
  • Swp73-like protein

Background

SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF6817
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-88719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058524-R01
Species: Hu
7668-GH/CF
Species: Hu
MAB6799
Species: Hu
Applications: WB, IHC
H00006603-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SMARCD2 Partial Recombinant Protein (H00006603-Q01) (0)

There are no publications for SMARCD2 Partial Recombinant Protein (H00006603-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCD2 Partial Recombinant Protein (H00006603-Q01) (0)

There are no reviews for SMARCD2 Partial Recombinant Protein (H00006603-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMARCD2 Partial Recombinant Protein (H00006603-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCD2 Products

Bioinformatics Tool for SMARCD2 Partial Recombinant Protein (H00006603-Q01)

Discover related pathways, diseases and genes to SMARCD2 Partial Recombinant Protein (H00006603-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD2 Partial Recombinant Protein (H00006603-Q01)

Discover more about diseases related to SMARCD2 Partial Recombinant Protein (H00006603-Q01).
 

Pathways for SMARCD2 Partial Recombinant Protein (H00006603-Q01)

View related products by pathway.

PTMs for SMARCD2 Partial Recombinant Protein (H00006603-Q01)

Learn more about PTMs related to SMARCD2 Partial Recombinant Protein (H00006603-Q01).
 

Research Areas for SMARCD2 Partial Recombinant Protein (H00006603-Q01)

Find related products by research area.

Blogs on SMARCD2

There are no specific blogs for SMARCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Brg1 Antibody
NB100-2594

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMARCD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD2