SMARCD2 Antibody (2F7) - Azide and BSA Free

Western Blot: SMARCD2 Antibody (2F7) [H00006603-M01] - SMARCD2 monoclonal antibody (M01), clone 2F7 Analysis of SMARCD2 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: SMARCD2 Antibody (2F7) [H00006603-M01] - Analysis of monoclonal antibody to SMARCD2 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: SMARCD2 Antibody (2F7) [H00006603-M01] - Analysis of monoclonal antibody to SMARCD2 on formalin-fixed paraffin-embedded human breast. Antibody concentration 3 ug/ml.

ELISA: SMARCD2 Antibody (2F7) [H00006603-M01] - Detection limit for recombinant GST tagged SMARCD2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SMARCD2 Antibody (2F7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
• Specificity: SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SMARCD2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCD2 Antibody (2F7) - Azide and BSA Free

• 60 kDa BRG-1/Brm-associated factor subunit B
• BAF60B
• BRG1-associated factor 60B
• chromatin remodeling complex BAF60B subunit
• CRACD2
• mammalian chromatin remodeling complex BRG1-associated factor 60B
• PRO2451
• Rsc6p
• SWI/SNF complex 60 kDa subunit B
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
• Swp73-like protein

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMARCD2 Antibody (H00006603-M01)(1)

Publication using H00006603-M01

• Ertl I, Brettner R, Kronabitter H et al. The SMARCD Family of SWI/SNF Accessory Proteins Is Involved in the Transcriptional Regulation of Androgen Receptor-Driven Genes and Plays a Role in Various Essential Processes of Prostate Cancer Cells 2022-12-28 [PMID: 36611918] (WB, Human)

Bioinformatics

• Gene Symbol: SMARCD2
• Entrez:
  • 6603(Human)
• OMIM:
  • 601736(Human)