Recombinant Human SMARCD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMARCD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 23012 of Human SMARCD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMARCD1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMARCD1 Protein

  • BAF60Amammalian chromatin remodeling complex BRG1-associated factor 60A
  • BRG1-associated factor 60A
  • chromatin remodeling complex BAF60A subunit
  • CRACD1
  • Rsc6p
  • subfamily d, member 1
  • SWI/SNF complex 60 kDa subunit A
  • SWI/SNF complex 60 kDa subunit
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 1,60 kDa BRG-1/Brm-associated factor subunit A
  • Swp73-like protein

Background

SMARCD1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00006603-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB

Publications for SMARCD1 Partial Recombinant Protein (H00006602-Q01) (0)

There are no publications for SMARCD1 Partial Recombinant Protein (H00006602-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCD1 Partial Recombinant Protein (H00006602-Q01) (0)

There are no reviews for SMARCD1 Partial Recombinant Protein (H00006602-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMARCD1 Partial Recombinant Protein (H00006602-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCD1 Products

Bioinformatics Tool for SMARCD1 Partial Recombinant Protein (H00006602-Q01)

Discover related pathways, diseases and genes to SMARCD1 Partial Recombinant Protein (H00006602-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD1 Partial Recombinant Protein (H00006602-Q01)

Discover more about diseases related to SMARCD1 Partial Recombinant Protein (H00006602-Q01).
 

Pathways for SMARCD1 Partial Recombinant Protein (H00006602-Q01)

View related products by pathway.

PTMs for SMARCD1 Partial Recombinant Protein (H00006602-Q01)

Learn more about PTMs related to SMARCD1 Partial Recombinant Protein (H00006602-Q01).
 

Research Areas for SMARCD1 Partial Recombinant Protein (H00006602-Q01)

Find related products by research area.

Blogs on SMARCD1

There are no specific blogs for SMARCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMARCD1 Antibody
NBP1-88719
ARID1A Antibody
NBP1-88932

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMARCD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD1