SMARCA1 Recombinant Protein Antigen

Images

 
There are currently no images for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMARCA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCA1.

Source: E. coli

Amino Acid Sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMARCA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56279.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMARCA1 Recombinant Protein Antigen

  • ATP-dependent helicase SMARCA1
  • DKFZp686D1623
  • EC 3.6.1
  • EC 3.6.4.-
  • FLJ41547
  • global transcription activator homologous sequence
  • Nucleosome-remodeling factor subunit SNF2L
  • NURF140
  • probable global transcription activator SNF2L1
  • SNF2L
  • SNF2L1ISWI
  • SNF2LB
  • SNF2-like 1
  • SNF2LT
  • subfamily a, member 1
  • sucrose nonfermenting 2-like protein 1
  • SWI
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1
  • SWI2

Background

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. Member of this family have helicase and ATPase activities that alter chromatin structure to facilitate gene transcription. SMARCA1/SNF2L is a component of the human NURF (nucleosome remodeling factor) involved in the regulation of genes involved in neuronal development. SMARCA1/SNF2L is also a component of the heterodimeric complex CERF [CECR2(cat eye syndrome chromosome region, candidate 2)-containing remodeling factor]. Alternate names for SMARCA1/SNF2L include SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SNF2, SNF2L, SNF2L1, SNF2LB, sucrose nonfermenting 2-like protein 1, NURF140, and ISWI.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5738
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90014
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20415
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-55310
Species: Hu, Mu
Applications: IP, WB
NBP1-88932
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-83256
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76978
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90012
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-90270
Species: Hu
Applications: IHC,  IHC-P
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-56279PEP
Species: Hu
Applications: AC

Publications for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP) (0)

There are no publications for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP) (0)

There are no reviews for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMARCA1 Recombinant Protein Antigen (NBP2-56279PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCA1 Products

Array NBP2-56279PEP

Blogs on SMARCA1

There are no specific blogs for SMARCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCA1