SMAC/Diablo Recombinant Protein Antigen

Images

 
There are currently no images for SMAC/Diablo Protein (NBP1-84262PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMAC/Diablo Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIABLO.

Source: E. coli

Amino Acid Sequence: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIABLO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84262.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMAC/Diablo Recombinant Protein Antigen

  • 0610041G12Rik
  • Diablo
  • diablo, IAP-binding mitochondrial protein
  • Direct IAP-binding protein with low pI
  • mitochondrial Smac protein
  • Second mitochondria-derived activator of caspase
  • SMAC
  • SMACmitochondrial

Background

Smac/DIABLO is a mitochondrial protein which activates various forms of apoptosis. Specifically, Smac exits the mitochondria and enters the cytosol where it initiates apoptosis by neutralizing members of the IAP family of apoptosis inhibitory proteins. Mitochondrial-mediated apoptosis is important in animal development and tissue homeostasis, with alterations resulting in a range of malignant disorders. Upon apoptotic stimuli, the mitochondrial proteins cytochrome c and Smac/DIABLO are released into the cytosol. The release of these proteins, however, occurs via different mechanisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1458
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-14214
Species: Hu
Applications: IHC,  IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-84262PEP
Species: Hu
Applications: AC

Publications for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no publications for SMAC/Diablo Protein (NBP1-84262PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no reviews for SMAC/Diablo Protein (NBP1-84262PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMAC/Diablo Products

Research Areas for SMAC/Diablo Protein (NBP1-84262PEP)

Find related products by research area.

Blogs on SMAC/Diablo.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMAC/Diablo Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DIABLO