SLCO5A1 Antibody

Images

 
Immunohistochemistry-Paraffin: SLCO5A1 Antibody [NBP1-82498] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLCO5A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
Specificity
Specificity of human SLCO5A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO5A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
WB reported in scientific literature (PMID: 26415544). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLCO5A1 Protein (NBP1-82498PEP)
Publications
Read Publications using
NBP1-82498 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%). Reactivity reported in scientific literature (PMID: 24179389)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLCO5A1 Antibody

  • FLJ39560
  • member 15
  • OATP5A1
  • OATPRP4
  • organic anion transporter polypeptide-related protein 4
  • SLC21A15
  • solute carrier organic anion transporter family, member 5A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59678
Species: Hu
Applications: WB
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-31584
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
NBP2-13349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78060
Species: Hu, Mu, Bv, Ca, Ch
Applications: WB, ELISA, ICC/IF
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-29430
Species: Hu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32914
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
H00051776-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82498
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLCO5A1 Antibody (NBP1-82498)(2)

Reviews for SLCO5A1 Antibody (NBP1-82498) (0)

There are no reviews for SLCO5A1 Antibody (NBP1-82498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLCO5A1 Antibody (NBP1-82498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLCO5A1 Products

Bioinformatics Tool for SLCO5A1 Antibody (NBP1-82498)

Discover related pathways, diseases and genes to SLCO5A1 Antibody (NBP1-82498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO5A1 Antibody (NBP1-82498)

Discover more about diseases related to SLCO5A1 Antibody (NBP1-82498).
 

Pathways for SLCO5A1 Antibody (NBP1-82498)

View related products by pathway.

Blogs on SLCO5A1

There are no specific blogs for SLCO5A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLCO5A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO5A1
Entrez
Uniprot