SLC9A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC9A2 Antibody [NBP1-82576] - Staining of human cell line A-431 shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC9A2 Antibody [NBP1-82576] - Staining of human stomach shows moderate luminal membrane and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC9A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC9A2 Protein (NBP1-82576PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC9A2 Antibody

  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), member 2
  • solute carrier family 9 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38280
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-62091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-80996
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SLC9A2 Antibody (NBP1-82576) (0)

There are no publications for SLC9A2 Antibody (NBP1-82576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A2 Antibody (NBP1-82576) (0)

There are no reviews for SLC9A2 Antibody (NBP1-82576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC9A2 Antibody (NBP1-82576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC9A2 Products

Bioinformatics Tool for SLC9A2 Antibody (NBP1-82576)

Discover related pathways, diseases and genes to SLC9A2 Antibody (NBP1-82576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC9A2 Antibody (NBP1-82576)

Discover more about diseases related to SLC9A2 Antibody (NBP1-82576).
 

Pathways for SLC9A2 Antibody (NBP1-82576)

View related products by pathway.

PTMs for SLC9A2 Antibody (NBP1-82576)

Learn more about PTMs related to SLC9A2 Antibody (NBP1-82576).

Blogs on SLC9A2

There are no specific blogs for SLC9A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC9A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A2