SLC7A8 Recombinant Protein Antigen

Images

 
There are currently no images for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC7A8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC7A8.

Source: E. coli

Amino Acid Sequence: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC7A8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49319.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC7A8 Recombinant Protein Antigen

  • hLAT2
  • integral membrane protein E16H
  • large neutral amino acids transporter small subunit 2
  • LAT2L-type amino acid transporter 2
  • LPI-PC1
  • solute carrier family 7 (amino acid transporter, L-type), member 8
  • Solute carrier family 7 member 8
  • y+ system), member 8

Background

Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
NB100-796
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-92440
Species: Hu
Applications: IHC,  IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP3-12294
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NBP1-88872
Species: Hu
Applications: IHC,  IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-75086
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-82826
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-35470
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-45311
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-22423
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB

Publications for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP) (0)

There are no publications for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP) (0)

There are no reviews for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC7A8 Products

Research Areas for SLC7A8 Recombinant Protein Antigen (NBP2-49319PEP)

Find related products by research area.

Blogs on SLC7A8

There are no specific blogs for SLC7A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC7A8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A8