SLC7A8 Antibody (3F10) - Azide and BSA Free

Sandwich ELISA: SLC7A8 Antibody (3F10) [H00023428-M01] - Detection limit for recombinant GST tagged SLC7A8 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 3F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC7A8 Antibody (3F10) - Azide and BSA Free Summary

• Immunogen: SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
• Specificity: SLC7A8 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 (3F10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC7A8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC7A8 Antibody (3F10) - Azide and BSA Free

• hLAT2
• integral membrane protein E16H
• large neutral amino acids transporter small subunit 2
• LAT2L-type amino acid transporter 2
• LPI-PC1
• solute carrier family 7 (amino acid transporter, L-type), member 8
• Solute carrier family 7 member 8
• y+ system), member 8

Background

Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC7A8 Antibody (H00023428-M01)(1)

Publication using H00023428-M01

• Li J, Mao Z, Huang J et al. PICK1 is Essential for Insulin Production and the Maintenance of Glucose Homeostasis. Mol Biol Cell 2018-01-03 [PMID: 29298842]

Bioinformatics

• Gene Symbol: SLC7A8
• Entrez:
  • 23428(Human)
• Uniprot:
  • NP_036376(Human)