Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988] - Western blot analysis of SLC7A5/LAT1 in Mouse Brain lysates. Antibody dilution at 1.0ug/ml
Effect of GW501516 on BCAA transport and catabolic enzymes. (a and b) Effect of treatment with GW501516 (GW) at 1 μM for 24 hours on (a) absolute media BCAA content or (b) control mean-normalized (within each ...read more
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP3-09988 in the following applications:
solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain
Solute carrier family 7 member 5
TA1
y+ system cationic amino acid transporter
Background
Mammalian cells have several amino acid transport systems. These systems have been defined by both activity and specific genes. L-type amino acid transporter 1 (LAT1) is a 12 membrane-spanning protein. LAT1 is a Na + -independent neutral amino acid transporter agency and essential for the transporter of large neutral amino acid such as Leucine, Isoleucine, and Valine through the plasma membrane. LAT1 has been proposed to be one of the major nutrient transport systems at the blood-brain barrier. Drugs such as L Dopa are transported by LAT1. LAT1 is thought to be up-regulated to support the high protein synthesis for cell growth in some tumor cell lines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLC7A5/LAT1 Antibody - BSA Free and receive a gift card or discount.