SLC7A2 Antibody

Immunocytochemistry/Immunofluorescence: SLC7A2 Antibody [NBP2-58924] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.

Product Discontinued

SLC7A2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC7A2 Antibody

• CAT2
• CAT-2
• cationic 2
• cationic amino acid transporter, y+ system
• low affinity cationic amino acid transporter 2
• low-affinity cationic amino acid transporter-2
• SLC7A2
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
• Solute carrier family 7 member 2

Background

Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC7A2