SLC7A10 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC7A10 Antibody [NBP1-88814] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSKPKCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC7A10 Protein (NBP1-88814PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A10 Antibody

  • ASC1
  • asc-1
  • asc-type amino acid transporter 1
  • FLJ20839
  • HASC-1
  • solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10
  • solute carrier family 7 member 10
  • solute carrier family 7, (cationic amino acid transporter, y+ system) member 10
  • solute carrier family 7, (neutral amino acid transporter, y+ system) member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-92067
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for SLC7A10 Antibody (NBP1-88814) (0)

There are no publications for SLC7A10 Antibody (NBP1-88814).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A10 Antibody (NBP1-88814) (0)

There are no reviews for SLC7A10 Antibody (NBP1-88814). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A10 Antibody (NBP1-88814) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A10 Products

Bioinformatics Tool for SLC7A10 Antibody (NBP1-88814)

Discover related pathways, diseases and genes to SLC7A10 Antibody (NBP1-88814). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A10 Antibody (NBP1-88814)

Discover more about diseases related to SLC7A10 Antibody (NBP1-88814).
 

Pathways for SLC7A10 Antibody (NBP1-88814)

View related products by pathway.

Blogs on SLC7A10

There are no specific blogs for SLC7A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A10