SLC7A10 Antibody

Product Discontinued

SLC7A10 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSKPKCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC7A10 Antibody

• ASC1
• asc-1
• asc-type amino acid transporter 1
• FLJ20839
• HASC-1
• solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10
• solute carrier family 7 member 10
• solute carrier family 7, (cationic amino acid transporter, y+ system) member 10
• solute carrier family 7, (neutral amino acid transporter, y+ system) member 10

Background

SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 (PubMed 10863037)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC7A10