SLC6A3/DAT1 Recombinant Protein Antigen

Images

 
There are currently no images for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC6A3/DAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A3.

Source: E. coli

Amino Acid Sequence: LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC6A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46649.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC6A3/DAT1 Recombinant Protein Antigen

  • DA transporter
  • DAT1
  • DATDAT1Solute carrier family 6 member 3
  • SLC6A3
  • sodium-dependent dopamine transporter
  • solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
  • VNTR

Background

The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse (Kish et al., 2001; Zhu et al., 2000; Zhu et al., 1999). Levels of DAT protein expression are altered by chronic drug administration (Wilson et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-D01P
Species: Hu, Mu
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP3-48739
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC,  IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
MAB8286
Species: Hu
Applications: IHC
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB

Publications for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP) (0)

There are no publications for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP) (0)

There are no reviews for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP). (Showing 1 - 1 of 1 FAQ).

  1. Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?
    • Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.

Additional SLC6A3/DAT1 Products

Research Areas for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP)

Find related products by research area.

Blogs on SLC6A3/DAT1

There are no specific blogs for SLC6A3/DAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC6A3/DAT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A3