SLC6A3/DAT1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SLC6A3/DAT1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A3.
  
  

  Source: E. coli

  Amino Acid Sequence: LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SLC6A3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46649.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC6A3/DAT1 Recombinant Protein Antigen

• DA transporter
• DAT1
• DATDAT1Solute carrier family 6 member 3
• SLC6A3
• sodium-dependent dopamine transporter
• solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
• VNTR

Background

The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse (Kish et al., 2001; Zhu et al., 2000; Zhu et al., 1999). Levels of DAT protein expression are altered by chronic drug administration (Wilson et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for SLC6A3/DAT1 Recombinant Protein Antigen (NBP2-46649PEP). (Showing 1 - 1 of 1 FAQ).

1. Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?
   • Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.

Bioinformatics

• Gene Symbol: SLC6A3