Recombinant Human SLC6A3/DAT1 GST (N-Term) Protein

SDS-Page: Recombinant Human SLC6A3/DAT1 Protein [H00006531-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human SLC6A3/DAT1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 161-237 of Human SLC6A3/DAT1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SLC6A3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 34.21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC6A3/DAT1 GST (N-Term) Protein

• DA transporter
• DAT1
• DATDAT1Solute carrier family 6 member 3
• SLC6A3
• sodium-dependent dopamine transporter
• solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
• VNTR

Background

SLC6A3 - solute carrier family 6 (neurotransmitter transporter, dopamine), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for SLC6A3/DAT1 Partial Recombinant Protein (H00006531-Q01). (Showing 1 - 1 of 1 FAQ).

1. Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?
   • Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.

Bioinformatics

• Gene Symbol: SLC6A3