SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen

Images

 
There are currently no images for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A2.

Source: E. coli

Amino Acid Sequence: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC6A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen

  • NAT1
  • NAT1neurotransmitter transporter
  • NET
  • NET1sodium-dependent noradrenaline transporter
  • Noradrenalin Transporter
  • Norepinephrine Transporter
  • SLC6A2
  • SLC6A5
  • solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
  • Solute carrier family 6 member 2
  • solute carrier family 6 member 5

Background

Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-33751
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-92167
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
DY4517-05
Species: Mu
Applications: ELISA
NBP1-81820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
8334-GT
Species: Hu
Applications: EnzAct
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-62704PEP
Species: Hu
Applications: AC

Publications for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)

There are no publications for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)

There are no reviews for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC6A2/NET/Noradrenaline transporter Products

Research Areas for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP)

Find related products by research area.

Blogs on SLC6A2/NET/Noradrenaline transporter

There are no specific blogs for SLC6A2/NET/Noradrenaline transporter, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A2