SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A2. Source: E. coli
Amino Acid Sequence: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SLC6A2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62704. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen
Background
Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)
There are no publications for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)
There are no reviews for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP) (0)
Additional SLC6A2/NET/Noradrenaline transporter Products
Research Areas for SLC6A2/NET/Noradrenaline transporter Recombinant Protein Antigen (NBP2-62704PEP)
Find related products by research area.
|
Blogs on SLC6A2/NET/Noradrenaline transporter