SLC6A16 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC6A16 Antibody [NBP2-57364] - Staining of human cell line A549 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC6A16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
Specificity
Specificity of human SLC6A16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A16
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC6A16 Recombinant Protein Antigen (NBP2-57364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC6A16 Antibody

  • NTT5solute carrier family 6 (neurotransmitter transporter), member 16
  • orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
  • Solute carrier family 6 member 16
  • solute carrier family 6, member 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-83867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NBP1-89327
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77368
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009197-M07
Species: Hu, Mu, Rt, Ha
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA

Publications for SLC6A16 Antibody (NBP2-57364) (0)

There are no publications for SLC6A16 Antibody (NBP2-57364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A16 Antibody (NBP2-57364) (0)

There are no reviews for SLC6A16 Antibody (NBP2-57364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC6A16 Antibody (NBP2-57364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC6A16 Products

Bioinformatics Tool for SLC6A16 Antibody (NBP2-57364)

Discover related pathways, diseases and genes to SLC6A16 Antibody (NBP2-57364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A16 Antibody (NBP2-57364)

Discover more about diseases related to SLC6A16 Antibody (NBP2-57364).
 

Pathways for SLC6A16 Antibody (NBP2-57364)

View related products by pathway.

Blogs on SLC6A16

There are no specific blogs for SLC6A16, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A16