SLC30A7 Antibody


Immunocytochemistry/ Immunofluorescence: SLC30A7 Antibody [NBP1-80578] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC30A7 Antibody [NBP1-80578] - Staining of human small intestine shows strong positivity of the luminal membrane in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC30A7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQI
Specificity of human SLC30A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC30A7 Protein (NBP1-80578PEP)
Read Publication using NBP1-80578.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC30A7 Antibody

  • DKFZp686M0368
  • solute carrier family 30 (zinc transporter), member 7
  • Solute carrier family 30 member 7
  • zinc transporter like 2
  • zinc transporter ZnT-7
  • ZnT-7
  • ZNT7zinc transporter 7
  • ZnTL2
  • Znt-like transporter 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Rt
Applications: ELISA, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SLC30A7 Antibody (NBP1-80578)(1)

Reviews for SLC30A7 Antibody (NBP1-80578) (0)

There are no reviews for SLC30A7 Antibody (NBP1-80578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC30A7 Antibody (NBP1-80578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC30A7 Products

Bioinformatics Tool for SLC30A7 Antibody (NBP1-80578)

Discover related pathways, diseases and genes to SLC30A7 Antibody (NBP1-80578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC30A7 Antibody (NBP1-80578)

Discover more about diseases related to SLC30A7 Antibody (NBP1-80578).

Pathways for SLC30A7 Antibody (NBP1-80578)

View related products by pathway.

Blogs on SLC30A7

There are no specific blogs for SLC30A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC30A7 Antibody and receive a gift card or discount.


Gene Symbol SLC30A7