SLC30A7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC30A7 Antibody [NBP1-80578] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC30A7 Antibody [NBP1-80578] - Staining of human small intestine shows strong positivity of the luminal membrane in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC30A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC30A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC30A7 Protein (NBP1-80578PEP)
Publications
Read Publication using NBP1-80578.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC30A7 Antibody

  • DKFZp686M0368
  • solute carrier family 30 (zinc transporter), member 7
  • Solute carrier family 30 member 7
  • zinc transporter like 2
  • zinc transporter ZnT-7
  • ZnT-7
  • ZNT7zinc transporter 7
  • ZnTL2
  • Znt-like transporter 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31673
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86824
Species: Hu
Applications: IHC, IHC-P
H00000265-M03
Species: Hu
Applications: WB, ELISA
NBP2-06015
Species: Hu
NBP2-31825
Species: Hu
Applications: IHC, IHC-P
AF7315
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6095
Species: Hu
Applications: WB
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-73013
Species: Rt
Applications: ELISA, S-ELISA
NBP1-76507
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SLC30A7 Antibody (NBP1-80578)(1)

Reviews for SLC30A7 Antibody (NBP1-80578) (0)

There are no reviews for SLC30A7 Antibody (NBP1-80578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC30A7 Antibody (NBP1-80578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC30A7 Products

Bioinformatics Tool for SLC30A7 Antibody (NBP1-80578)

Discover related pathways, diseases and genes to SLC30A7 Antibody (NBP1-80578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC30A7 Antibody (NBP1-80578)

Discover more about diseases related to SLC30A7 Antibody (NBP1-80578).
 

Pathways for SLC30A7 Antibody (NBP1-80578)

View related products by pathway.

Blogs on SLC30A7

There are no specific blogs for SLC30A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC30A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC30A7