SLC39A14 Antibody (1J6T5)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1J6T5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC39A14 Antibody (1J6T5) Summary

• Description: Novus Biologicals Rabbit SLC39A14 Antibody (1J6T5) (NBP3-33524) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-157 of human SLC39A14 (NP_001121903.1).
  
  Sequence:
  SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SLC39A14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SLC39A14 Antibody (1J6T5)

• Irt-like protein 14
• LIV-1 subfamily of ZIP zinc transporter 4
• LZT-Hs4
• solute carrier family 39 (metal ion transporter), member 14
• solute carrier family 39 (zinc transporter), member 14
• solute carrier family 39 member 14
• zinc transporter ZIP14
• ZIP14
• ZIP-14
• zrt- and Irt-like protein 14

Background

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A14 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 (PubMed 12659941)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A14