SLC35C2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC35C2 Antibody [NBP2-32008] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry: SLC35C2 Antibody [NBP2-32008] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC35C2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC35C2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC35C2 Protein (NBP2-32008PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC35C2 Antibody

  • bA394O2.1
  • C20orf5
  • CGI-15
  • FLJ37039
  • FLJ46434
  • MGC20633
  • MGC32079
  • MGC39183
  • ovarian cancer overexpressed 1
  • Ovarian cancer-overexpressed gene 1 protein
  • OVCOV1
  • solute carrier family 35 member C2
  • solute carrier family 35, member C2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NBP1-32954
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59386
Species: Hu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-32008
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC35C2 Antibody (NBP2-32008) (0)

There are no publications for SLC35C2 Antibody (NBP2-32008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35C2 Antibody (NBP2-32008) (0)

There are no reviews for SLC35C2 Antibody (NBP2-32008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC35C2 Antibody (NBP2-32008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC35C2 Products

Bioinformatics Tool for SLC35C2 Antibody (NBP2-32008)

Discover related pathways, diseases and genes to SLC35C2 Antibody (NBP2-32008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35C2 Antibody (NBP2-32008)

Discover more about diseases related to SLC35C2 Antibody (NBP2-32008).
 

Pathways for SLC35C2 Antibody (NBP2-32008)

View related products by pathway.

PTMs for SLC35C2 Antibody (NBP2-32008)

Learn more about PTMs related to SLC35C2 Antibody (NBP2-32008).

Blogs on SLC35C2

There are no specific blogs for SLC35C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC35C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35C2
Uniprot