Zinc transporter 9 Antibody

Images

 
Western Blot: Zinc transporter 9 Antibody [NBP2-83813] - WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Immunohistochemistry: Zinc transporter 9 Antibody [NBP2-83813] - Human Liver

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zinc transporter 9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Zinc transporter 9. Peptide sequence: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC30A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zinc transporter 9 Antibody

  • C4orf1GRIP1-dependent nuclear receptor coactivator
  • chromosome 4 open reading frame 1
  • GAC63
  • HuEL
  • HUELexpressed in human embryonic lung
  • Human embryonic lung protein
  • solute carrier family 30 (zinc transporter), member 9
  • Solute carrier family 30 member 9
  • zinc transporter 9
  • ZNT9
  • znT-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2364
Species: Hu
Applications: IHC, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-95127
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-88809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80523
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00007782-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF3416
Species: Hu
Applications: WB
NBP2-06015
Species: Hu
Applications: WB
NBP2-45600
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NBP3-10172
Species: Mu
Applications: WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP2-31673
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80578
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Zinc transporter 9 Antibody (NBP2-83813) (0)

There are no publications for Zinc transporter 9 Antibody (NBP2-83813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc transporter 9 Antibody (NBP2-83813) (0)

There are no reviews for Zinc transporter 9 Antibody (NBP2-83813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zinc transporter 9 Antibody (NBP2-83813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zinc transporter 9 Products

Bioinformatics Tool for Zinc transporter 9 Antibody (NBP2-83813)

Discover related pathways, diseases and genes to Zinc transporter 9 Antibody (NBP2-83813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zinc transporter 9 Antibody (NBP2-83813)

Discover more about diseases related to Zinc transporter 9 Antibody (NBP2-83813).
 

Pathways for Zinc transporter 9 Antibody (NBP2-83813)

View related products by pathway.

PTMs for Zinc transporter 9 Antibody (NBP2-83813)

Learn more about PTMs related to Zinc transporter 9 Antibody (NBP2-83813).

Blogs on Zinc transporter 9

There are no specific blogs for Zinc transporter 9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zinc transporter 9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC30A9