SLC2A4RG Antibody

Images

 
Western Blot: SLC2A4RG Antibody [NBP2-88297] - WB Suggested Anti-SLC2A4RG Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity Hu, Rt, Bv, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC2A4RG Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A4RG. Peptide sequence: MQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (92%), Bovine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A4RG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC2A4RG Antibody

  • GEFHDBP-1
  • HDBP1GLUT4 enhancer factor
  • Huntington disease gene regulatory region-binding protein 1
  • Huntington's disease gene regulatory region-binding protein 1
  • Si-1-2
  • Si-1-2-19
  • SLC2A4 regulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48615
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19188
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-22527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-88297
Species: Hu, Rt, Bv, Ca, Eq
Applications: WB

Publications for SLC2A4RG Antibody (NBP2-88297) (0)

There are no publications for SLC2A4RG Antibody (NBP2-88297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC2A4RG Antibody (NBP2-88297) (0)

There are no reviews for SLC2A4RG Antibody (NBP2-88297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC2A4RG Antibody (NBP2-88297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC2A4RG Products

Bioinformatics Tool for SLC2A4RG Antibody (NBP2-88297)

Discover related pathways, diseases and genes to SLC2A4RG Antibody (NBP2-88297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC2A4RG Antibody (NBP2-88297)

Discover more about diseases related to SLC2A4RG Antibody (NBP2-88297).
 

Pathways for SLC2A4RG Antibody (NBP2-88297)

View related products by pathway.

PTMs for SLC2A4RG Antibody (NBP2-88297)

Learn more about PTMs related to SLC2A4RG Antibody (NBP2-88297).

Blogs on SLC2A4RG

There are no specific blogs for SLC2A4RG, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC2A4RG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A4RG