SLC29A3 Antibody - BSA Free

Western Blot: SLC29A3 Antibody [NBP2-58230] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: SLC29A3 Antibody [NBP2-58230] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC29A3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEYWMFKLRNSSSPATGEDPEGSDILNYFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC29A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC29A3 Recombinant Protein Antigen (NBP2-58230PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC29A3 Antibody - BSA Free

• equilibrative nucleoside transporter 3
• ENT3
• HCLAP
• hENT3
• HJCD
• PHID
• SLC29A3
• solute carrier family 29 (nucleoside transporters), member 3
• UNQ717/PRO1380

Background

Nucleoside transporters, such as SLC29A3, mediate uptake of precursors for nucleotide synthesis by salvage pathways. They are also required for uptake of hydrophilic anticancer and antiviral nucleoside drugs (Baldwin et al., 2005 (PubMed 15701636)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC29A3