SLC26A9 Antibody


Immunocytochemistry/ Immunofluorescence: SLC26A9 Antibody [NBP2-30425] - Staining of human cell line A549 shows localization to cell junctions. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC26A9 Antibody [NBP2-30425] - Staining in human stomach and pancreas tissues using anti-SLC26A9 antibody. Corresponding SLC26A9 RNA-seq data are presented more
Immunohistochemistry-Paraffin: SLC26A9 Antibody [NBP2-30425] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SLC26A9 Antibody [NBP2-30425] - Staining of human stomach shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SLC26A9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
Specificity of human SLC26A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC26A9 Protein (NBP2-30425PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC26A9 Antibody

  • Anion transporter/exchanger protein 9
  • anion transporter/exchanger-9
  • solute carrier family 26 member 9
  • solute carrier family 26, member 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC26A9 Antibody (NBP2-30425) (0)

There are no publications for SLC26A9 Antibody (NBP2-30425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A9 Antibody (NBP2-30425) (0)

There are no reviews for SLC26A9 Antibody (NBP2-30425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC26A9 Antibody (NBP2-30425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC26A9 Antibody (NBP2-30425)

Discover related pathways, diseases and genes to SLC26A9 Antibody (NBP2-30425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A9 Antibody (NBP2-30425)

Discover more about diseases related to SLC26A9 Antibody (NBP2-30425).

Pathways for SLC26A9 Antibody (NBP2-30425)

View related products by pathway.

PTMs for SLC26A9 Antibody (NBP2-30425)

Learn more about PTMs related to SLC26A9 Antibody (NBP2-30425).

Blogs on SLC26A9

There are no specific blogs for SLC26A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC26A9 Antibody and receive a gift card or discount.


Gene Symbol SLC26A9