SLC26A9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC26A9 Antibody [NBP2-30425] - Staining of human cell line A549 shows localization to cell junctions.
Immunohistochemistry-Paraffin: SLC26A9 Antibody [NBP2-30425] - Staining of human salivary gland shows moderate membranous positivity in glandular cells.
Immunohistochemistry: SLC26A9 Antibody [NBP2-30425] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC26A9 Protein (NBP2-30425PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC26A9 Antibody

  • Anion transporter/exchanger protein 9
  • anion transporter/exchanger-9
  • solute carrier family 26 member 9
  • solute carrier family 26, member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NB110-60965
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47273
Species: Hu
Applications: IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-03340
Species: Hu
Applications: WB, IP
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NBP1-91997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30425
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC26A9 Antibody (NBP2-30425) (0)

There are no publications for SLC26A9 Antibody (NBP2-30425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A9 Antibody (NBP2-30425) (0)

There are no reviews for SLC26A9 Antibody (NBP2-30425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC26A9 Antibody (NBP2-30425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A9 Products

Bioinformatics Tool for SLC26A9 Antibody (NBP2-30425)

Discover related pathways, diseases and genes to SLC26A9 Antibody (NBP2-30425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A9 Antibody (NBP2-30425)

Discover more about diseases related to SLC26A9 Antibody (NBP2-30425).
 

Pathways for SLC26A9 Antibody (NBP2-30425)

View related products by pathway.

PTMs for SLC26A9 Antibody (NBP2-30425)

Learn more about PTMs related to SLC26A9 Antibody (NBP2-30425).

Blogs on SLC26A9

There are no specific blogs for SLC26A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A9
Uniprot