SLC26A2 Antibody (3F6)

Images

 
Western Blot: SLC26A2 Antibody (3F6) [H00001836-M04] - Analysis of SLC26A2 expression in transfected 293T cell line by SLC26A2 monoclonal antibody (M04), clone 3F6. Lane 1: SLC26A2 transfected lysatE (81.6 KDa). Lane 2: ...read more
Sandwich ELISA: SLC26A2 Antibody (3F6) [H00001836-M04] - Detection limit for recombinant GST tagged SLC26A2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC26A2 Antibody (3F6) Summary

Immunogen
SLC26A2 (NP_000103.1, 1 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNI
Specificity
SLC26A2 - solute carrier family 26 (sulfate transporter), member 2 (3F6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC26A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using
H00001836-M04 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC26A2 Antibody (3F6)

  • D5S1708
  • Diastrophic dysplasia protein
  • diastrophic dysplasia sulfate transporter
  • DTDMSTP157
  • DTDSTMST153
  • EDM4
  • solute carrier family 26 (sulfate transporter), member 2
  • Solute carrier family 26 member 2
  • sulfate anion transporter 1
  • sulfate transporter

Background

The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00001297-T01
Species: Hu
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-89533
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA

Publications for SLC26A2 Antibody (H00001836-M04)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC26A2 Antibody (H00001836-M04) (0)

There are no reviews for SLC26A2 Antibody (H00001836-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A2 Antibody (H00001836-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A2 Products

Bioinformatics Tool for SLC26A2 Antibody (H00001836-M04)

Discover related pathways, diseases and genes to SLC26A2 Antibody (H00001836-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A2 Antibody (H00001836-M04)

Discover more about diseases related to SLC26A2 Antibody (H00001836-M04).
 

Pathways for SLC26A2 Antibody (H00001836-M04)

View related products by pathway.

PTMs for SLC26A2 Antibody (H00001836-M04)

Learn more about PTMs related to SLC26A2 Antibody (H00001836-M04).

Blogs on SLC26A2

There are no specific blogs for SLC26A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A2 Antibody (3F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A2
Entrez
Uniprot