SLC25A36 Antibody - Azide and BSA Free

Western Blot: SLC25A36 Antibody [H00055186-B01P] - Analysis of SLC25A36 expression in transfected 293T cell line by SLC25A36 polyclonal antibody. Lane 1: SLC25A36 transfected lysate(34.32 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC25A36 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SLC25A36 Antibody - Azide and BSA Free (H00055186-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLC25A36 (AAH14064, 1 a.a. - 311 a.a.) full-length human protein. MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG
• Specificity: SLC25A36 - solute carrier family 25, member 36,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SLC25A36
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A36 Antibody - Azide and BSA Free

• DKFZp564C053
• FLJ10618
• solute carrier family 25 member 36
• solute carrier family 25, member 36

Background

SLC25A36, also known as Solute carrier family 25 member 36, has 311 amino acid isoform that is 34 kDa, a 132 amino acid isoform that is 14 kDa, a 310 amino acid isoform that is 34 kDa, and a 154 amino acid long isoform that is 17 kDa; is located in mitochondrion inner membrane, belongs to mitochondrial carrier family and it is a multi-pass membrane protein with unknown function. This protein is associated with multiple sclerosis, glaucoma and breast cancer. Interactions with the SLC25A36 protein have been shown to involve PTN, XPNPEP3, CAMKK2, ICK and PRKACB in transport, response to estradiol stimulus, and transmembrane transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A36
• Entrez:
  • 55186(Human)
• Uniprot:
  • AAH14064(Human)