SLC25A3 Antibody - BSA Free

Western Blot: SLC25A3 Antibody [NBP2-86810] - Host: Rabbit. Target Name: SLC25A3. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 2.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC25A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC25A3 Antibody - BSA Free (NBP2-86810) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC25A3. Peptide sequence: NPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A3 Antibody - BSA Free

• PHCmitochondrial phosphate carrier protein
• phosphate carrier protein, mitochondrial
• Phosphate transport protein
• PTP
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
• Solute carrier family 25 member 3

Background

SLC25A3 is encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A3