SLC25A28 Antibody - BSA Free

Western Blot: SLC25A28 Antibody [NBP1-59562] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.

Immunohistochemistry-Paraffin: SLC25A28 Antibody [NBP1-59562] - Human kidney Tissue, antibody concentration 5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC25A28 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the C terminal of SLC25A28. Peptide sequence NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A28 Antibody - BSA Free

• DKFZp547C109
• hMRS3/4
• MFRN2
• Mitochondrial iron transporter 2
• Mitochondrial RNA-splicing protein 3/4 homolog
• mitoferrin-2
• MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4
• NPD016
• putative mitochondrial solute carrier
• Solute carrier family 25 member 28
• solute carrier family 25, member 28

Background

SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC25A28 Antibody (NBP1-59562)(1)

Publication using NBP1-59562

• Song, JX;Zhao, YS;Zhen, YQ;Yang, XY;Chen, Q;An, JR;Ji, ES; Banxia-Houpu decoction diminishes iron toxicity damage in heart induced by chronic intermittent hypoxia Pharmaceutical biology [PMID: 35286247] (Mouse)

Bioinformatics

• Gene Symbol: SLC25A28
• Uniprot:
  • Q96A46(Human)