SLC25A23 Antibody - BSA Free

Western Blot: SLC25A23 Antibody [NBP3-35429] - Western blot analysis of various lysates using SLC25A23 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: SLC25A23 Antibody [NBP3-35429] - Immunofluorescence analysis of NIH/3T3 cells using SLC25A23 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC25A23 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC25A23 Antibody - BSA Free (NBP3-35429) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SLC25A23 (NP_077008.2).
  
  Sequence:
  MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A23
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC25A23 Antibody - BSA Free

• APC2FLJ30339
• calcium-binding mitochondrial carrier protein SCaMC-3
• MCSC2
• MGC2615
• Mitochondrial ATP-Mg/Pi carrier protein 2
• Mitochondrial Ca(2+)-dependent solute carrier protein 2
• mitochondrial Ca2+-dependent solute carrier protein 2
• SCAMC3
• SCaMC-3
• short calcium-binding mitochondrial carrier 3
• Small calcium-binding mitochondrial carrier protein 3
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
• Solute carrier family 25 member 23

Background

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A23