SLC25A23 Antibody

Images

 
Western Blot: SLC25A23 Antibody [NBP2-13321] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SLC25A23 Antibody [NBP2-13321] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDG GLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A23 Protein (NBP2-13321PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A23 Antibody

  • APC2FLJ30339
  • calcium-binding mitochondrial carrier protein SCaMC-3
  • MCSC2
  • MGC2615
  • Mitochondrial ATP-Mg/Pi carrier protein 2
  • Mitochondrial Ca(2+)-dependent solute carrier protein 2
  • mitochondrial Ca2+-dependent solute carrier protein 2
  • SCAMC3
  • SCaMC-3
  • short calcium-binding mitochondrial carrier 3
  • Small calcium-binding mitochondrial carrier protein 3
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
  • Solute carrier family 25 member 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-45493
Species: Hu, Mk
Applications: WB, IHC, IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82886
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA

Publications for SLC25A23 Antibody (NBP2-13321) (0)

There are no publications for SLC25A23 Antibody (NBP2-13321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A23 Antibody (NBP2-13321) (0)

There are no reviews for SLC25A23 Antibody (NBP2-13321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A23 Antibody (NBP2-13321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A23 Products

Bioinformatics Tool for SLC25A23 Antibody (NBP2-13321)

Discover related pathways, diseases and genes to SLC25A23 Antibody (NBP2-13321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A23 Antibody (NBP2-13321)

Discover more about diseases related to SLC25A23 Antibody (NBP2-13321).
 

Pathways for SLC25A23 Antibody (NBP2-13321)

View related products by pathway.

Blogs on SLC25A23

There are no specific blogs for SLC25A23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A23