Recombinant Human SLC25A11 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC25A11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-314 of Human SLC25A11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
60.17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A11 Protein

  • OGCmitochondrial 2-oxoglutarate/malate carrier protein
  • OGCP
  • SLC20A4solute carrier family 20 (oxoglutarate carrier), member 4
  • solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member11
  • Solute carrier family 25 member 11

Background

SLC25A11( AAH16294, 1 a.a. - 315 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38249
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65594
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43762
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
H00008402-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLC25A11 Recombinant Protein (H00008402-P01) (0)

There are no publications for SLC25A11 Recombinant Protein (H00008402-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A11 Recombinant Protein (H00008402-P01) (0)

There are no reviews for SLC25A11 Recombinant Protein (H00008402-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A11 Recombinant Protein (H00008402-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC25A11 Recombinant Protein (H00008402-P01)

Discover related pathways, diseases and genes to SLC25A11 Recombinant Protein (H00008402-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A11 Recombinant Protein (H00008402-P01)

Discover more about diseases related to SLC25A11 Recombinant Protein (H00008402-P01).
 

Pathways for SLC25A11 Recombinant Protein (H00008402-P01)

View related products by pathway.

PTMs for SLC25A11 Recombinant Protein (H00008402-P01)

Learn more about PTMs related to SLC25A11 Recombinant Protein (H00008402-P01).

Blogs on SLC25A11

There are no specific blogs for SLC25A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A11