SLC25A10 Antibody - BSA Free

Western Blot: SLC25A10 Antibody [NBP2-83542] - Host: Rabbit. Target Name: SLC25A10. Sample Tissue: Human DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SLC25A10 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC25A10. Peptide sequence: LAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A10 Antibody - BSA Free

• dicarboxylate ion carrier
• DICSolute carrier family 25 member 10
• member 10
• mitochondrial dicarboxylate carrier
• solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter)

Background

The mitochondrial dicarboxylate carrier protein (mDIC) belongs to superfamily of mitochondrial transporters. It has been demonstrated that the expression of mDIC leads to hyperpolarization of the mitochondria, as well as succinate uptake by the mitochondria. It is highly expressed in adipose tissue, where its expression is downregulated by insulin and upregulated by free fatty acids. mDIC is also thought to play a role in glyceroneogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A10