SLC20A2 Antibody


Western Blot: SLC20A2 Antibody [NBP1-69702] - This Anti-SLC20A2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity Hu, PoSpecies Glossary
Applications WB

Order Details

SLC20A2 Antibody Summary

Synthetic peptides corresponding to SLC20A2(solute carrier family 20 (phosphate transporter), member 2) The peptide sequence was selected from the N terminal of SLC20A2. Peptide sequence DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC20A2 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-69702 in the following applications:

  • WB
    1 publication

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 28111052).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC20A2 Antibody

  • Gibbon ape leukemia virus receptor 2
  • Glvr-2
  • GLVR2PIT-2
  • hPit2
  • murine leukemia virus, amphotropic, receptor for
  • Phosphate transporter 2
  • pit2
  • PiT-2
  • sodium-dependent phosphate transporter 2
  • solute carrier family 20 (phosphate transporter), member 2
  • Solute carrier family 20 member 2


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Po
Applications: WB

Publications for SLC20A2 Antibody (NBP1-69702)(1)

We have publications tested in 1 confirmed species: Porcine.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SLC20A2 Antibody (NBP1-69702) (0)

There are no reviews for SLC20A2 Antibody (NBP1-69702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC20A2 Antibody (NBP1-69702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC20A2 Products

Bioinformatics Tool for SLC20A2 Antibody (NBP1-69702)

Discover related pathways, diseases and genes to SLC20A2 Antibody (NBP1-69702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC20A2 Antibody (NBP1-69702)

Discover more about diseases related to SLC20A2 Antibody (NBP1-69702).

Pathways for SLC20A2 Antibody (NBP1-69702)

View related products by pathway.

PTMs for SLC20A2 Antibody (NBP1-69702)

Learn more about PTMs related to SLC20A2 Antibody (NBP1-69702).

Blogs on SLC20A2

There are no specific blogs for SLC20A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC20A2 Antibody and receive a gift card or discount.


Gene Symbol SLC20A2