![Western Blot: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded rat liver using SLC1A4 .](http://images.novusbio.com/fullsize/SLC1A4-Antibody-Western-Blot-NBP2-95196-img0004.jpg "Western Blot: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded rat liver using SLC1A4 .")
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SLC1A4 (P43007). ELNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC1A4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC1A4 |
![Immunohistochemistry-Paraffin: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded mouse kidney using SLC1A4 .](http://images.novusbio.com/fullsize/SLC1A4-Antibody-Immunohistochemistry-Paraffin-NBP2-95196-img0003.jpg "Immunohistochemistry-Paraffin: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded mouse kidney using SLC1A4 .")
![Western Blot: SLC1A4 Antibody [NBP2-95196] - Analysis of extracts of various cell lines, using SLC1A4 at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.](http://images.novusbio.com/fullsize/SLC1A4-Antibody-Western-Blot-NBP2-95196-img0005.jpg "Western Blot: SLC1A4 Antibody [NBP2-95196] - Analysis of extracts of various cell lines, using SLC1A4 at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.")
![Immunohistochemistry-Paraffin: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded human esophagus using SLC1A4 .](http://images.novusbio.com/fullsize/SLC1A4-Antibody-Immunohistochemistry-Paraffin-NBP2-95196-img0001.jpg "Immunohistochemistry-Paraffin: SLC1A4 Antibody [NBP2-95196] - Paraffin-embedded human esophagus using SLC1A4 .")
