SLC16A12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC16A12 Antibody [NBP1-82789] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC16A12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC16A12 Antibody

  • CJMG
  • DKFZp686E188
  • MCT 12
  • MCT12
  • MCT12monocarboxylate transporter 12
  • SLC16A12
  • solute carrier family 16 (monocarboxylic acid transporters), member 12
  • Solute carrier family 16 member 12
  • solute carrier family 16, member 12 (monocarboxylic acid transporter 12)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84615
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2948
Species: Mu
Applications: WB, Simple Western, ELISA, IHC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
H00004948-Q01
Species: Hu
NBP2-04611
Species: Hu
MAB4960
Species: Mu
Applications: WB, IHC
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NB300-132
Species: Hu, Mu, Rt, Av, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-79801
Species: Hu
Applications: WB
MAB6544
Species: Hu
Applications: IHC
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC16A12 Antibody (NBP1-82789) (0)

There are no publications for SLC16A12 Antibody (NBP1-82789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC16A12 Antibody (NBP1-82789) (0)

There are no reviews for SLC16A12 Antibody (NBP1-82789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC16A12 Antibody (NBP1-82789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC16A12 Products

SLC16A12 NBP1-82789

Bioinformatics Tool for SLC16A12 Antibody (NBP1-82789)

Discover related pathways, diseases and genes to SLC16A12 Antibody (NBP1-82789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC16A12 Antibody (NBP1-82789)

Discover more about diseases related to SLC16A12 Antibody (NBP1-82789).
 

Pathways for SLC16A12 Antibody (NBP1-82789)

View related products by pathway.

PTMs for SLC16A12 Antibody (NBP1-82789)

Learn more about PTMs related to SLC16A12 Antibody (NBP1-82789).

Blogs on SLC16A12

There are no specific blogs for SLC16A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC16A12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A12
Entrez