SLC13A5 Antibody (2G4) [Alexa Fluor® 488]

Product Discontinued

SLC13A5 Antibody (2G4) [Alexa Fluor® 488] Summary

• Immunogen: SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC13A5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: IgG purified

Alternate Names for SLC13A5 Antibody (2G4) [Alexa Fluor® 488]

• DKFZp686E17257
• Na(+)/citrate cotransporter
• NaCT
• NACTMGC138356
• SLC13A5
• Sodium-coupled citrate transporter
• Sodium-dependent citrate transporter
• solute carrier family 13 (sodium-dependent citrate transporter), member 5
• solute carrier family 13 member 5
• solute carrier family 13, member 5

Background

SLC13A5 is a tricarboxylate plasma transporter with a preference for citrate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A5