SLC13A5 Antibody (2G4) - Azide and BSA Free

Western Blot: SLC13A5 Antibody (2G4) [H00284111-M06] - Analysis of SLC13A5 expression in HepG2 (Cat # L019V1).

Immunohistochemistry-Paraffin: SLC13A5 Antibody (2G4) [H00284111-M06] - Analysis of monoclonal antibody to SLC13A5 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml

ELISA: SLC13A5 Antibody (2G4) [H00284111-M06] - Detection limit for recombinant GST tagged SLC13A5 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC13A5 Antibody (2G4) - Azide and BSA Free Summary

• Immunogen: SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC13A5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC13A5 Antibody (2G4) - Azide and BSA Free

• DKFZp686E17257
• Na(+)/citrate cotransporter
• NaCT
• NACTMGC138356
• SLC13A5
• Sodium-coupled citrate transporter
• Sodium-dependent citrate transporter
• solute carrier family 13 (sodium-dependent citrate transporter), member 5
• solute carrier family 13 member 5
• solute carrier family 13, member 5

Background

SLC13A5 is a tricarboxylate plasma transporter with a preference for citrate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A5
• Uniprot:
  • NP_808218(Human)