SLC13A3/NaDC3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC13A3/NaDC3 Antibody [NBP2-68586] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC13A3/NaDC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC13A3/NaDC3 Antibody - BSA Free (NBP2-68586) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC13A3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for SLC13A3/NaDC3 Antibody - BSA Free

• hNaDC3
• Na(+)/dicarboxylate cotransporter 3
• NaDC3
• NaDC-3
• NADC3SDCT2naDC-3
• SDCT2
• SLC13A3
• sodium-dependent high affinity dicarboxylate transporter 3
• Sodium-dependent high-affinity dicarboxylate transporter 2
• solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
• solute carrier family 13 member 3

Background

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A3