SLC13A2 Antibody - BSA Free

Western Blot: SLC13A2 Antibody [NBP1-62518] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: SLC13A2 Antibody [NBP1-62518] - Human small intestine tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC13A2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC13A2(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2) The peptide sequence was selected from the middle region of SLC13A2. Peptide sequence PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC13A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC13A2 Antibody - BSA Free

• Na(+)/dicarboxylate cotransporter 1
• NADC1Na(+)-coupled citrate transporter
• NaDC-1NaCT
• Renal sodium/dicarboxylate cotransporter
• SDCT1
• solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
• solute carrier family 13 member 2

Background

SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC13A2
• Uniprot:
  • Q13183(Human)