Skp1 Antibody

Western Blot: Skp1 Antibody [H00006500-D01P] - Analysis of SKP1 expression in transfected 293T cell line by SKP1 polyclonal antibody.Lane 1: SKP1 transfected lysate(18.10 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Skp1 Antibody [H00006500-D01P] - Analysis of protein-protein interactions between SKP1 and CACYBP. HeLa cells were stained with anti-SKP1 rabbit purified polyclonal 1:1200 and anti-CACYBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

Skp1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SKP1 (NP_008861.2, 1 a.a. - 160 a.a.) full-length human protein. MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
• Specificity: SKP1 - S-phase kinase-associated protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Skp1 Antibody

• Cyclin-A/CDK2-associated protein p19
• EMC19p19skp1
• MGC34403
• OCP2
• OCP2OCP-2
• OCP-IIS-phase kinase-associated protein 1A (p19A)
• Organ of Corti protein 2
• Organ of Corti protein II
• p19a
• p19Acyclin A/CDK2-associated p19
• p19Skp1
• RNA polymerase II elongation factor-like protein OCP2
• RNA polymerase II elongation factor-like protein
• SKP1
• SKP1A
• SKP1Acyclin A/CDK2-associated protein p19
• S-phase kinase-associated protein 1
• TCEB1LSIII
• Transcription elongation factor B

Background

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKP1
• Entrez:
  • 6500(Human)
• Uniprot:
  • NP_008861.2(Human)