Recombinant Human SKAP55 Protein

Images

 
SDS-Page: Recombinant Human SKAP55 Protein [H00008631-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SKAP55 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human SKAP55

Source: Wheat Germ

Amino Acid Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SKAP55 Protein

  • SCAP1
  • SCAP1pp55
  • SKAP1
  • SKAP55
  • SKAP55SKAP-55
  • src family associated phosphoprotein 1
  • Src family-associated phosphoprotein 1
  • src kinase associated phosphoprotein 1
  • src kinase-associated phosphoprotein 1
  • Src kinase-associated phosphoprotein of 55 kDa

Background

SCAP1 - src family associated phosphoprotein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3857
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
AF7279
Species: Hu, Mu
Applications: WB, ICC
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
796-IC
Species: Mu
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no publications for SKAP55 Partial Recombinant Protein (H00008631-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no reviews for SKAP55 Partial Recombinant Protein (H00008631-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Discover related pathways, diseases and genes to SKAP55 Partial Recombinant Protein (H00008631-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Discover more about diseases related to SKAP55 Partial Recombinant Protein (H00008631-Q01).
 

Pathways for SKAP55 Partial Recombinant Protein (H00008631-Q01)

View related products by pathway.

PTMs for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Learn more about PTMs related to SKAP55 Partial Recombinant Protein (H00008631-Q01).

Blogs on SKAP55

There are no specific blogs for SKAP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SKAP55 Antibody
NBP1-87836
ICAM-1/CD54
796-IC-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SKAP55 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SKAP1