Home » SKAP55 » SKAP55 Proteins » Recombinant Human SKAP55 Protein

Recombinant Human SKAP55 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human SKAP55 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human SKAP55

Source: Wheat Germ

Amino Acid Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SKAP55 Protein

  • SCAP1
  • SCAP1pp55
  • SKAP1
  • SKAP55
  • SKAP55SKAP-55
  • src family associated phosphoprotein 1
  • Src family-associated phosphoprotein 1
  • src kinase associated phosphoprotein 1
  • src kinase-associated phosphoprotein 1
  • Src kinase-associated phosphoprotein of 55 kDa

Background

SCAP1 - src family associated phosphoprotein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FYB/ADAP/SLAP130
Antibody [Unconjugate ...
AF3857
Western blot shows nuclear extracts of Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human FYB/ADAP/SLAP130 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3857) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for FYB/ADAP/SLAP130 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu
Applications: WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Integrin alpha
L/CD11a Antibody (MEM ...
NB500-328
Flow Cytometry: Integrin alpha L/CD11a Antibody (MEM-25) [NB500-328] - Analysis using the PE conjugate of NB500-328. Surface staining of human peripheral blood cells with anti-human CD11a (MEM-25) PE.
(18 Publications)
Species: Hu
Applications: Flow, IP, CyTOF-ready
Integrin beta
2/CD18 Antibody
AF1730
Integrin  beta 2/CD18 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using 10 µg/mL Goat Anti-Human Integrin  beta 2/CD18 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1730) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(6 Publications)
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(11 Reviews)
(233 Publications)
Species: Hu
SCAP2 Antibody
NBP2-47288
Western Blot: SCAP2 Antibody [NBP2-47288] - Analysis in control (vector only transfected HEK293T lysate) and SKAP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells.
Immunocytochemistry/Immunofluorescence: SCAP2 Antibody [NBP2-47288] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.
Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47288] - Staining in human lymph node and pancreas tissues using anti-SKAP2 antibody. Corresponding SKAP2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TERF2IP Antibody
NB100-292
Western Blot: TERF2IP Antibody [NB100-292] - Detection of Human RAP1 by Western Blot. Samples: Whole cell lysate (15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RAP1 antibody NB100-292 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: TERF2IP Antibody [NB100-292] - Samples: FFPE sections of human lung carcinoma.~~ Antibody: Affinity purified rabbit anti-RAP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunoprecipitation: TERF2IP Antibody [NB100-292] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinitypurified rabbit anti-RAP1 antibody used for IP at 6 ug per reaction. RAP1 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-RAP1 antibody. For blotting immunoprecipitated RAP1, was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(19 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
SLP-76/LCP2 [p
Tyr145] Antibody (776 ...
MAB7474
Western blot shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-SLP‑76/LCP2 at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Human SLP‑76/LCP2 (Y145) at approximately 76-80 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
SLP‑76/LCP2 phosphorylated at Y145 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu
Applications: WB, Simple Western, ICC
RIAM/APBB1IP
Antibody
AF7279
Western blot shows lysates of THP‑1 human acute monocytic leukemia cell line and EL‑4 mouse lymphoblast cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human RIAM/APBB1IP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7279) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RIAM/APBB1IP at approximately 100-110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
RIAM/APBB1IP was detected in immersion fixed Wi-38 human lung fibroblast cell line using Sheep Anti-Human RIAM/APBB1IP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7279) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC
RAP1A Antibody
(1D4-1A3)
NBP2-22527
Western Blot: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of 25 ug of various whole cell lysate per well.
Immunocytochemistry/Immunofluorescence: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 (green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% BSA/TBST for 15 minutes at room temperature. Cells were probed with a Rap1 monoclonal antibody at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis showing staining in the cytoplasm and membrane of human colon carcinoma (right) compared to a negative control without primary antibody (left).
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NORE1 Antibody
NB500-248
Western Blot: NORE1 Antibody [NB500-248] - Analysis of NORE1 using this antibody at 1:1000 dilution on 293 T cell lysates overexpressed with NORE1.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Rabex5 Antibody
NBP1-49938
Western Blot: Rabex5 Antibody [NBP1-49938] - Detection of Human and Mouse RABGEF1 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RABGEF1 antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. RABGEF1 was also immunoprecipitated by rabbit anti-RABGEF1 antibody which recognizes a downstream epitope. For blotting immunoprecipitated RABGEF1 was used. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
Immunohistochemistry: Rabex5 Antibody [NBP1-49938] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RABGEF1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Pleckstrin
Antibody (OTI6H8)
NBP2-02300
Western Blot: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pleckstrin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pleckstrin.
Immunohistochemistry-Paraffin: Pleckstrin Antibody (6H8) [NBP2-02300] Staining of paraffin-embedded prostate tissue using anti-Pleckstrin mouse monoclonal antibody.
Flow Cytometry: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells transfected with either pCMV6-ENTRY Pleckstrin.(Red) or empty vector control plasmid (Blue) were immunostained with anti-Pleckstrin mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
ICAM-1/CD54
796-IC
ICAM-1/CD54
(51 Publications)
Species: Mu
Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
CD3 Antibody
(OKT3) - Low Endotoxi ...
NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Analysis of CD3+ hPMBCs using the APC conjugate of this antibody. A cell surface stain was performed on CD3+ hPBMCs with V alpha 24 J alpha 18 TCR antibody (6B11) NBP2-00267PE (top image) and a matched isotype control NBP2-27287 (bottom image). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. A co-stain was also performed using CD3 antibody NBP2-24867APC.
Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.
Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.
(8 Publications)
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
ILK Antibody (4F10)
H00003611-M01
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10. Analysis of ILK expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: ILK Antibody (4F10) [H00003611-M01] - Analysis of monoclonal antibody to ILK on Jurkat cell. Antibody concentration 10 ug/ml.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - Analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi ( Cat # H00003611-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody (M01) clone 4F10 (Cat # H00003611-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
GRASP55 Antibody
NBP1-89747
Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: GRASP55 Antibody [NBP1-89747] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
(2 Reviews)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GRB2 Antibody
NB100-866
Western Blot: GRB2 Antibody [NB100-866] - (0.05ug/ml) staining of Mouse (A+C) and Rat (B+D) Brain (A+B) and Spleen (C+D) lysates (35ug total protein in RIPA buffer). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: GRB2 Antibody [NB100-866] - Negative Control showing staining of paraffin embedded Human Lymph Node, with no primary antibody.
Western Blot: GRB2 Antibody [NB100-866] - (0.03ug/ml) staining of Human (A) and Pig (B) Spleen lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no publications for SKAP55 Partial Recombinant Protein (H00008631-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no reviews for SKAP55 Partial Recombinant Protein (H00008631-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SKAP55 Partial Recombinant Protein (H00008631-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Discover related pathways, diseases and genes to SKAP55 Partial Recombinant Protein (H00008631-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Discover more about diseases related to SKAP55 Partial Recombinant Protein (H00008631-Q01).
 

Pathways for SKAP55 Partial Recombinant Protein (H00008631-Q01)

View related products by pathway.

PTMs for SKAP55 Partial Recombinant Protein (H00008631-Q01)

Learn more about PTMs related to SKAP55 Partial Recombinant Protein (H00008631-Q01).

Blogs on SKAP55

There are no specific blogs for SKAP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human SKAP55 Protein
H00008631-P01-2ug
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
IL-2 [Unconjugated]
202-IL-010
Immunocytochemistry/Immunofluorescence: SKAP55 Antibody [NBP1-87836] - Staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
SKAP55 Antibody
NBP1-87836
ICAM-1/CD54
796-IC-050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SKAP55 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SKAP1
Entrez