SIRP alpha/CD172a Recombinant Protein Antigen

Images

 
There are currently no images for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIRP alpha/CD172a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIRP alpha/CD172a.

Source: E. coli

Amino Acid Sequence: NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIRPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58429.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIRP alpha/CD172a Recombinant Protein Antigen

  • BIT
  • BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs
  • Brain Ig-like molecule with tyrosine-based activation motifs
  • CD172 antigen-like family member A
  • CD172a antigen
  • CD172a
  • Inhibitory receptor SHPS-1
  • Macrophage fusion receptor
  • MFR
  • MFRtyrosine phosphatase SHP substrate 1
  • MyD-1 antigen
  • MYD1
  • MYD-1
  • P84
  • protein tyrosine phosphatase, non-receptor type substrate 1
  • PTPNS1
  • SHP substrate 1
  • SHPS1
  • SHPS-1
  • SHPS1CD172A
  • signal-regulatory protein alpha
  • Signal-regulatory protein alpha-1
  • Signal-regulatory protein alpha-2
  • Signal-regulatory protein alpha-3
  • SIRP alpha
  • SIRPA
  • SIRPalpha
  • Sirp-alpha-1
  • SIRPalpha2
  • Sirp-alpha-2
  • Sirp-alpha-3
  • SIRPtyrosine-protein phosphatase non-receptor type substrate 1

Background

Protein tyrosine phosphatases (PTPases) SHP-1 and SHP-2 are critical regulators in the intracellular signaling pathways that result in cell responses such as mitosis, differentiation, migration, survival, transformation or death. SHP-2 is a signal transducer for several receptor tyrosine kinases and cytokine receptors. A novel SHP-2 associated glycoprotein was recently cloned from human, rat, mouse and cattle by several labs and was designated SIRPa (1), SHPS-1 (2,3), MyD-1 (4), BIT (5,6) and p84 (7). SIRPa is a new gene family containing at least fifteen members. SIRPa is a substrate of many activated tyrosine kinases such as insulin receptor, EGFR, PDGFR and src, and a specific docking protein for SHP-2 (1,2,5,8). SIRPa has regulatory effects on cellular responses induced by serum, growth factors, insulin, oncogenes, growth hormones and cell adhesion and plays a general role in different physiological and pathological processes (1,2,5,8).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
DBD00
Species: Hu
Applications: ELISA

Publications for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP) (0)

There are no publications for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP) (0)

There are no reviews for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIRP alpha/CD172a Products

Research Areas for SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP)

Find related products by research area.

Blogs on SIRP alpha/CD172a

There are no specific blogs for SIRP alpha/CD172a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIRP alpha/CD172a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRPA