SIPA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SIPA1 Antibody [NBP2-32620] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli & plasma membrane.
Immunohistochemistry: SIPA1 Antibody [NBP2-32620] - Staining of human tonsil shows strong cytoplasmic positivity in non germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIPA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SIPA1 Protein (NBP2-32620PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIPA1 Antibody

  • GTPase-activating protein Spa-1
  • MGC102688
  • MGC17037
  • p130 SPA-1
  • signal-induced proliferation-associated 1
  • signal-induced proliferation-associated protein 1
  • sipa-1
  • SPA1signal-induced proliferation-associated gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBP2-32620
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SIPA1 Antibody (NBP2-32620) (0)

There are no publications for SIPA1 Antibody (NBP2-32620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIPA1 Antibody (NBP2-32620) (0)

There are no reviews for SIPA1 Antibody (NBP2-32620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SIPA1 Antibody (NBP2-32620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIPA1 Products

Bioinformatics Tool for SIPA1 Antibody (NBP2-32620)

Discover related pathways, diseases and genes to SIPA1 Antibody (NBP2-32620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIPA1 Antibody (NBP2-32620)

Discover more about diseases related to SIPA1 Antibody (NBP2-32620).
 

Pathways for SIPA1 Antibody (NBP2-32620)

View related products by pathway.

PTMs for SIPA1 Antibody (NBP2-32620)

Learn more about PTMs related to SIPA1 Antibody (NBP2-32620).
 

Research Areas for SIPA1 Antibody (NBP2-32620)

Find related products by research area.

Blogs on SIPA1

There are no specific blogs for SIPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIPA1