We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Sin1/MAPKAP1 Recombinant Protein Antigen

Images

 
There are currently no images for Sin1/MAPKAP1 Protein (NBP1-89568PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sin1/MAPKAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAPKAP1.

Source: E. coli

Amino Acid Sequence: ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAPKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89568.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sin1/MAPKAP1 Recombinant Protein Antigen

  • JC310
  • MAPKAP1
  • MEKK2-interacting protein 1
  • MGC2745
  • MIP1
  • MIP1SIN1SIN1b
  • Mitogen-activated protein kinase 2-associated protein 1
  • mitogen-activated protein kinase associated protein 1
  • mSIN1
  • ras inhibitor MGC2745
  • SAPK-interacting protein 1
  • Sin1
  • SIN1g
  • stress-activated map kinase interacting protein 1
  • Stress-activated map kinase-interacting protein 1
  • stress-activated protein kinase-interacting 1
  • target of rapamycin complex 2 subunit MAPKAP1
  • TORC2 subunit MAPKAP1

Background

Sin1 is a novel component of the eukaryotic SAPK pathway. Sin1 and the H3 and H4 histones interact genetically, with the C terminus of Sin1 physically associating with components of the SWI-SNF complex. This interaction is blocked by the N-terminal half of the protein in full length Sin1. It has been proposed that Sin1 acts as a regulatable bridge between the SWI-SNF complex and the nucleosome Sin1 is also required for effective transcription via the AP-1 factor Pap1, but does not prevent its nuclear translocation. Sin1 is a novel component of the eukaryotic SAPK pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-612
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-16729
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, Simple Western, WB
AF4004
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-76573
Species: Hu, Mu
Applications: ELISA, ICC, ICC/IF, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Sin1/MAPKAP1 Protein (NBP1-89568PEP) (0)

There are no publications for Sin1/MAPKAP1 Protein (NBP1-89568PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sin1/MAPKAP1 Protein (NBP1-89568PEP) (0)

There are no reviews for Sin1/MAPKAP1 Protein (NBP1-89568PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sin1/MAPKAP1 Protein (NBP1-89568PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sin1/MAPKAP1 Products

Research Areas for Sin1/MAPKAP1 Protein (NBP1-89568PEP)

Find related products by research area.

Blogs on Sin1/MAPKAP1

There are no specific blogs for Sin1/MAPKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sin1/MAPKAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAP1