SIM2 Antibody (3E6.)

Images

 
Sandwich ELISA: SIM2 Antibody (3E6) [H00006493-M01] - Detection limit for recombinant GST tagged SIM2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SIM2 Antibody (3E6.) Summary

Immunogen
SIM2 (NP_005060 426 a.a. - 525 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE
Specificity
SIM2 - single-minded homolog 2 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIM2 Antibody (3E6.)

  • human transcription factor SIM2, homolog of the Drosophila single-minded geneSIM110BHLHE15
  • short isoform
  • single-minded (Drosophila) homolog 2
  • single-minded homolog 2 (Drosophila)
  • transcription factor SIM2

Background

SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on the mapping position, its potential function as transcriptional repressor and similarity to Drosophila sim, it is proposed that SIM2 may contribute to some specific Down syndrome phenotypes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55947
Species: Hu
Applications: ICC/IF
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00006493-M01
Species: Hu
Applications: WB, ELISA

Publications for SIM2 Antibody (H00006493-M01) (0)

There are no publications for SIM2 Antibody (H00006493-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIM2 Antibody (H00006493-M01) (0)

There are no reviews for SIM2 Antibody (H00006493-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIM2 Antibody (H00006493-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIM2 Products

Bioinformatics Tool for SIM2 Antibody (H00006493-M01)

Discover related pathways, diseases and genes to SIM2 Antibody (H00006493-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIM2 Antibody (H00006493-M01)

Discover more about diseases related to SIM2 Antibody (H00006493-M01).
 

Pathways for SIM2 Antibody (H00006493-M01)

View related products by pathway.

PTMs for SIM2 Antibody (H00006493-M01)

Learn more about PTMs related to SIM2 Antibody (H00006493-M01).
 

Research Areas for SIM2 Antibody (H00006493-M01)

Find related products by research area.

Blogs on SIM2

There are no specific blogs for SIM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIM2 Antibody (3E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SIM2
Entrez
OMIM
Uniprot