SIK3 Antibody

Images

 
Western Blot: SIK3 Antibody [NBP1-69207] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIK3 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0999 (SIK family kinase 3) The peptide sequence was selected from the middle region of KIAA0999. Peptide sequence LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIAA0999 and was validated on Western blot.
Theoretical MW
139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIK3 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0999L19
  • QSKFLJ12240
  • Salt-inducible kinase 3
  • Serine/threonine-protein kinase QSK
  • serine/threonine-protein kinase SIK3
  • SIK family kinase 3
  • SIK-3

Background

The function of KIAA0999 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-81212
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SIK3 Antibody (NBP1-69207) (0)

There are no publications for SIK3 Antibody (NBP1-69207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIK3 Antibody (NBP1-69207) (0)

There are no reviews for SIK3 Antibody (NBP1-69207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIK3 Antibody (NBP1-69207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIK3 Products

Bioinformatics Tool for SIK3 Antibody (NBP1-69207)

Discover related pathways, diseases and genes to SIK3 Antibody (NBP1-69207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIK3 Antibody (NBP1-69207)

Discover more about diseases related to SIK3 Antibody (NBP1-69207).
 

Pathways for SIK3 Antibody (NBP1-69207)

View related products by pathway.

PTMs for SIK3 Antibody (NBP1-69207)

Learn more about PTMs related to SIK3 Antibody (NBP1-69207).
 

Research Areas for SIK3 Antibody (NBP1-69207)

Find related products by research area.

Blogs on SIK3

There are no specific blogs for SIK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIK3
Uniprot