SIK1/Snf1lk Antibody

Images

 
Western Blot: SIK1/Snf1lk Antibody [NBP1-82417] - Titration: 1.0 ug/ml Positive Control: Rat Lung.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIK1/Snf1lk Antibody Summary

Immunogen
Synthetic peptide towards Snf1lk. Peptide sequence TPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Sik1 and was validated on Western blot.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-82417 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIK1/Snf1lk Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • msk
  • myocardial SNF1-like kinase
  • salt-inducible kinase 1
  • Salt-inducible protein kinase 1
  • serine/threonine protein kinase
  • serine/threonine-protein kinase SIK1
  • Serine/threonine-protein kinase SNF1-like kinase 1
  • Serine/threonine-protein kinase SNF1LK
  • SIK
  • SIK-1
  • SNF1-like kinase
  • SNF1LKMSK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3966
Species: Hu
Applications: WB, IHC
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF2518
Species: Hu, Mu
Applications: WB, ICC
NBP2-80423
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF189
Species: Hu, Mu
Applications: WB, IHC
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-82417
Species: Rt
Applications: WB

Publications for SIK1/Snf1lk Antibody (NBP1-82417)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-82417 Applications Species
Song DF, Yin L, Wang C, Wen XY. Adenovirus-mediated expression of SIK1 improves hepatic glucose and lipid metabolism in type 2 diabetes mellitus rats bioRxiv Jan 7 2019 (WB, Rat) WB Rat

Reviews for SIK1/Snf1lk Antibody (NBP1-82417) (0)

There are no reviews for SIK1/Snf1lk Antibody (NBP1-82417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIK1/Snf1lk Antibody (NBP1-82417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SIK1/Snf1lk Products

Bioinformatics Tool for SIK1/Snf1lk Antibody (NBP1-82417)

Discover related pathways, diseases and genes to SIK1/Snf1lk Antibody (NBP1-82417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIK1/Snf1lk Antibody (NBP1-82417)

Discover more about diseases related to SIK1/Snf1lk Antibody (NBP1-82417).
 

Pathways for SIK1/Snf1lk Antibody (NBP1-82417)

View related products by pathway.

PTMs for SIK1/Snf1lk Antibody (NBP1-82417)

Learn more about PTMs related to SIK1/Snf1lk Antibody (NBP1-82417).

Blogs on SIK1/Snf1lk

There are no specific blogs for SIK1/Snf1lk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIK1/Snf1lk Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIK1
Uniprot