SIK1/Snf1lk Antibody - BSA Free

Western Blot: SIK1/Snf1lk Antibody [NBP1-53156] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Immunohistochemistry-Paraffin: SIK1/Snf1lk Antibody [NBP1-53156] - Human Stomach Tissue, Surface mucous cells and Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SIK1/Snf1lk Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SNF1LK(SNF1-like kinase) The peptide sequence was selected from the N terminal of SNF1LK. Peptide sequence MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIK1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SIK1/Snf1lk Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• msk
• myocardial SNF1-like kinase
• salt-inducible kinase 1
• Salt-inducible protein kinase 1
• serine/threonine protein kinase
• serine/threonine-protein kinase SIK1
• Serine/threonine-protein kinase SNF1-like kinase 1
• Serine/threonine-protein kinase SNF1LK
• SIK
• SIK1
• SIK-1
• SIK1/Snf1lk
• SNF1-like kinase
• SNF1LK
• SNF1LKMSK

Background

SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIK1
• Uniprot:
  • P57059(Human)