Recombinant Human Signal Peptide Peptidase GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Signal Peptide Peptidase GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human HM13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HM13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Theoretical MW
41.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Signal Peptide Peptidase GST (N-Term) Protein

  • dJ324O17.1
  • EC 3.4.23.-
  • H13hIMP1
  • histocompatibility (minor) 13
  • IMP-1
  • IMP1MSTP086
  • Intramembrane protease 1
  • minor histocompatibility antigen 13
  • minor histocompatibility antigen H13
  • Presenilin-like protein 3
  • PSENL3
  • PSL3IMPAS
  • signal peptide peptidase beta
  • Signal peptide peptidase
  • SPPIMPAS-1

Background

The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-87512
Species: Hu
Applications: IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84339
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55109
Species: Hu
Applications: ICC/IF
MAB4077
Species: Hu
Applications: WB, IHC

Publications for Signal Peptide Peptidase Recombinant Protein (H00081502-P01) (0)

There are no publications for Signal Peptide Peptidase Recombinant Protein (H00081502-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal Peptide Peptidase Recombinant Protein (H00081502-P01) (0)

There are no reviews for Signal Peptide Peptidase Recombinant Protein (H00081502-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Signal Peptide Peptidase Recombinant Protein (H00081502-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Signal Peptide Peptidase Products

Bioinformatics Tool for Signal Peptide Peptidase Recombinant Protein (H00081502-P01)

Discover related pathways, diseases and genes to Signal Peptide Peptidase Recombinant Protein (H00081502-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal Peptide Peptidase Recombinant Protein (H00081502-P01)

Discover more about diseases related to Signal Peptide Peptidase Recombinant Protein (H00081502-P01).
 

Pathways for Signal Peptide Peptidase Recombinant Protein (H00081502-P01)

View related products by pathway.

Blogs on Signal Peptide Peptidase

There are no specific blogs for Signal Peptide Peptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Signal Peptide Peptidase GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HM13